PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn118321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 173aa    MW: 18608.8 Da    PI: 6.9064
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn118321genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.33.1e-4410108199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++el+++++
  Achn118321  10 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEIMPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVMRLQKELDATNA 108
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.5699110IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4310107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MASSSTSNSP CAACKFLRRK CLPGCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEIMP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVMRLQ KELDATNADL MRFTSNDISN  120
SSFSVFPGQY GARMGHGGGS FDHNSGFSLP YASPWNNNPT GGSSEEGGDG TM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273053.19e-92PREDICTED: LOB domain-containing protein 25
RefseqXP_010660868.19e-92PREDICTED: LOB domain-containing protein 25
SwissprotQ9FML41e-69LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLF6HUW21e-91F6HUW2_VITVI; Putative uncharacterized protein
STRINGVIT_14s0066g00680.t013e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-70LBD family protein